BMP-4 Recombinant Protein
CAT:
209-M10-044
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
BMP-4 Recombinant Protein
- Description: Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.
- Synonyms: Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1
- CAS Number: 9000-83-3
- NCBI Gene ID: 12159
- UniProt: P21275
- Accession Number: NP_031580
- Accession Number mRNA: NM_007554
- Gene Location: 14 C1; 14 15.0 cM
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
- Detection Range: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: >98% by SDS-PAGE & HPLC analysis
- Length: 106
- Form: Lyophilized
- Buffer: 10mM Citric Acid
- Reconstitution: Centrifuge vial prior to opening. Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
- Molecular Weight: 23.9 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.