FGF-21, Human

CAT: 0804-HY-P7012-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7012-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

FGF-21 Protein, Human is an atypical member of the ﬁbroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Name Alternative

FGF-21 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human.html

Purity

95.00

Smiles

GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209, with an N-terminal Gly) (Accession)

Molecular Weight

Approximately 19.4 kDa

References & Citations

[1]Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69 (12) :1802-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P7173-01	FGF-21, Mouse
HY-P72650-01	FGF-21, Cynomolgus (HEK293, His)
HY-P75762-01	FGF-21, Hamster (HEK293, His)
HY-P72651-01	FGF-21, Mouse (HEK293, His)
HY-174268	FGFR-IN-21
HY-P7172-01	FGF-19, Human
HY-P704520-01	FGF-BP1, Human
HY-P7346	FGF-8, Human
HY-P700287-01	FGF-17, Human
HY-P7123-01	FGF-18, Human

Alternative Products

Catalog	Name
600109	Human FGF-21
MBS8575267-01	FGF-21, Human
OM300867-01	FGF 21 Human
BL10136_R	Recombinant Human FGF-21
4066-10	FGF-21, human recombinant
PRP1030-01	Human FGF 21 Protein
UA040013-01	FGF-21 Protein, Human
Z03207-50	FGF-21, His, Human
OM300907-01	FGF 21 Human, His
GTR18885700-01	Human FGF-21 protein

FGF-21, Human

Related Products

Alternative Products

Popular Products