FGF-19, Human

CAT: 0804-HY-P7172-01Size: 2 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7172-01Size:2 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Name Alternative

FGF-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (R23-K216) (Accession)

Molecular Weight

Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kir S, et al. FGF19 as a postprandial, insulin-independent activator of hepatic protein and glycogen synthesis. Science. 2011 Mar 25;331 (6024) :1621-4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-172922	FGFR-IN-19
HY-P704520-01	FGF-BP1, Human
HY-P7346	FGF-8, Human
HY-P700287-01	FGF-17, Human
HY-P7123-01	FGF-18, Human
HY-P7014-01	FGF-4, Human
HY-P7001-01	FGF-1, Human
HY-P7177-01	FGF-9, Human
HY-P7013-01	FGF-23, Human
HY-P72803-01	FGF-13, Human

Alternative Products

Catalog	Name
OM300895-01	FGF 19 Human
HC66610	Human FGF-19
E34M108H	FGF-19, Human
4542-1000	FGF-19, human recombinant
P5489-100μg	Recombinant Human FGF-19
OM300883-01	FGF 19 Human, His
GTR18985410-01	Human FGF 19 Protein
PR27019-25	FGF-19 Human Protein
GTR18881660-01	Human FGF-19 protein
UA040086-01	FGF-19 Protein, Human

FGF-19, Human

Related Products

Alternative Products

Popular Products