FGF-18, Human

• Description :

  FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

• Product Name Alternative :

  FGF-18 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Applications :

  Neuroscience-Neuromodulation

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-18-protein-human.html

• Purity :

  95.00

• Smiles :

  AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

• Molecular Formula :

  8817 (Gene_ID) O76093 (A27-R199) (Accession)

• Molecular Weight :

  Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins