FGF-18, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FGF-18, Human
Description :
FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.Product Name Alternative :
FGF-18 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsApplications :
Neuroscience-NeuromodulationAssay Protocol :
https://www.medchemexpress.com/cytokines/fgf-18-protein-human.htmlPurity :
95.00Smiles :
AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRMolecular Formula :
8817 (Gene_ID) O76093 (A27-R199) (Accession)Molecular Weight :
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

