NT-4, Mouse

• Description :

  NT-4 Protein, Mouse is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .

• Product Name Alternative :

  NT-4 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/nt-4-protein-mouse.html

• Purity :

  95.0

• Smiles :

  MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA

• Molecular Formula :

  78405 (Gene_ID) Q80VU4 (G80-A209) (Accession)

• Molecular Weight :

  Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins