IL-4, Mouse

• Description:

  IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag[1][2][3].

• Product Name Alternative:

  IL-4 Protein, Mouse, Mouse, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-4-protein-mouse.html

• Purity:

  98.0

• Smiles:

  HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

• Molecular Formula:

  16189 (Gene_ID) P07750 (H23-S140) (Accession)

• Molecular Weight:

  Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]I-Cheng Ho, et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.|[2]Keegan AD, et al. Recent advances in understanding the role of IL-4 signaling. Fac Rev. 2021 Sep 7;10:71.|[3]Choi P, et al. IL-4: role in disease and regulation of production. Clin Exp Immunol. 1998 Sep;113 (3) :317-9.|[4]Chen BD, et al. Murine recombinant IL-4 is a bifunctional regulator of macrophage growth induced by colony-stimulating factors. J Immunol. 1992 Feb 1;148 (3) :753-9.|[5]Myburgh E, et al. Murine IL-4 is able to signal via chimeric human IL-4Ralpha/mouse gamma-chain receptor. Mol Immunol. 2008 Mar;45 (5) :1327-36.|[6]Ren X, et al. Recombinant murine interleukin 4 protein therapy for psoriasis in a transgenic VEGF mouse model. Dermatology. 2009;219 (3) :232-8.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins