Goat anti-GFAP Polyclonal antibody
CAT:
894-AB0165-100
Size:
300 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Goat anti-GFAP Polyclonal antibody
- Description: Goat polyclonal antibody to GFAP. Glial fibrillary acidic protein is a major intermediate filament protein of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development.
- Specifications: Detects endogenous levels of GFAP by Western blot.
- Alternative Name: ALXDRD, glial fibrillary acidic protein antibody.
- UNSPSC Description: Glial fibrillary acidic protein
- Volume: 100 µL
- Gene ID: ENSG00000131095
- Accession Number: ENSG00000131095
- Host: Goat
- Antigen Species: Human
- Reactivity: Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
- Immunogen: Recombinant peptide derived from within residues 375 aa to the C-terminus of human GFAP produced in E. coli.
- Target Antigen: Recombinant peptide derived from within residues 375 aa to the C-terminus of human GFAP produced in E. coli.
- Immunogen Type: Recombinant protein
- Target: Anti-GFAP
- Clonality: Polyclonal
- Isotype: IgG
- Conjugation: Unconjugated
- Type: Primary
- Sequence: ENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
- Applications: WB
- Purification: Epitope affinity purified
- Concentration: 3 mg/mL
- Dilution: WB:1:500-1:5,000
- Form: Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Buffer: PBS, 20% glycerol and 0.05% sodium azide
- Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.