Goat anti-SNCB Polyclonal antibody

Goat anti-SNCB Polyclonal antibody

• Description: Goat polyclonal antibody to SNCB. Beta-Synuclein is a member of Synuclein family which includes alpha and gamma. SNCB inhibits phospholipase D2 and may function in neuronal plasticity. It is a non-amyloid component of senile plaques found in Alzheimer disease and can act as a regulator of SNCA aggregation process.
• Specifications: Detects endogenous levels of SNCB by Western blot. This Ab is specific for SNCB and does not recognizes SNCA and SNCG proteins.
• Product Name Alternative: Beta-Synuclein, Synuclein Beta antibody.
• CAS Number: 9007-83-4
• UNSPSC Description: Synuclein Beta
• Volume: 100 µL
• Gene ID: ENSG00000074317
• Accession Number: ENSG00000074317
• Host: Goat
• Antigen Species: Human
• Reactivity: Reacts against human, rat, mouse, canine and monkey proteins
• Immunogen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli.
• Target Antigen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: Anti-SNCB
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
• Applications: WB
• Purification: Epitope affinity purified
• Concentration: 2 mg/mL
• Dilution: WB:1:500-1:5,000
• Form: Polyclonal antibody supplied as a 100 µl (2 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.