Goat anti-NPY1R Polyclonal antibody

Goat anti-NPY1R Polyclonal antibody

• Description: Goat polyclonal antibody to NPY1R. This protein belongs to the G-protein-coupled receptor superfamily. It is a transmembrane protein that mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity.
• Specifications: Detects endogenous levels of NPY1R by Western blot.
• Product Name Alternative: neuropeptide Y receptor Y1, NPYR, NPY1-R antibody.
• CAS Number: 9007-83-4
• UNSPSC Description: Neuropeptide Y receptor Y1
• Volume: 100 µL
• Gene ID: ENSG00000164128
• Accession Number: ENSG00000164128
• Host: Goat
• Antigen Species: Human
• Reactivity: Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
• Immunogen: Purified recombinant peptide derived from within residues 300 aa to the C-terminus of human NPY1R produced in E. coli.
• Target Antigen: Purified recombinant peptide derived from within residues 300 aa to the C-terminus of human NPY1R produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: Anti-NPY1R
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: ENKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
• Applications: WB
• Purification: Epitope affinity purified
• Concentration: 3 mg/mL
• Dilution: WB:1:500-1:5,000
• Form: Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.