Goat anti-Rab35 Polyclonal antibody

Goat anti-Rab35 Polyclonal antibody

• Description: RAB35 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. Rab35 is restricted to the plasma membrane and endocytic compartments and controls a fast endocytic-recycling pathway.
• Specifications: Detects Rab35 in cell lysates and transfected cells by Western blot.
• Product Name Alternative: RAB1C, GTP-binding protein RAY, H-ray, ras-related protein Rab-35; ras-related protein rab-1C and RAY antibody.
• CAS Number: 9007-83-4
• UNSPSC Description: RA35, member RAS oncogene family
• Volume: 200 µL
• Gene ID: ENSG00000111737
• Accession Number: ENSG00000111737
• Host: Goat
• Antigen Species: Mouse
• Reactivity: Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
• Immunogen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab35 produced in E. coli.
• Target Antigen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab35 produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: Anti-Rab35
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: MNQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
• Applications: WB
• Purification: Epitope affinity purified
• Concentration: 4 mg/mL
• Dilution: WB:1:250-1:2,000
• Form: Polyclonal antibody supplied as a 200 µl (4 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.