Cdk6 Antibody

CAT:
800-R32480
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Cdk6 Antibody - image 1

Cdk6 Antibody

  • Description:

    Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.
  • Specifications:

    Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL
  • UniProt:

    Q00534
  • Host:

    Rabbit
  • Reactivity:

    Human, Rat
  • Immunogen:

    Amino acids TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN from the human protein were used as the immunogen for the Cdk6 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, IHC-P
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    Prior to reconstitution, store at 4oC. After reconstitution, the Cdk6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This Cdk6 antibody is available for research use only.
  • Storage Conditions:

    Prior to reconstitution, store at 4°C. After reconstitution, the Cdk6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the Cdk6 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Nuclear, cytoplasmic
  • Image Legend:

    IHC staining of FFPE human intestinal cancer with Cdk6 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.