Products for Research Use Only

RecombinantCNTF, Human (HEK293-expressed)

CAT: 0384-BK0300-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0300-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: dorsal root ganglion sensory neurons, sympathetic ganglion neurons, embryonic motor neurons, major pelvic ganglion neurons and hippocampal neurons. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The gene for human CNTF has been localized to the proximal region of the long arm of chromosome 11. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL-6, IL-11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.20 μg/ml, measured in a cell proliferation assay using TF-1 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
22~28 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Ciliary Neurotrophic Factor (CNTF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Ciliary Neurotrophic Factor (CNTF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAY RTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLK VLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Popular Products