Products for Research Use Only
RegisterLogin

RecombinantRANTES/CCL5, Human (HEK293-expressed)

CAT: 0013-GTR18990214-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990214-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Chemokine (C-C motif) ligand 5 (CCL5), also known as RANTES (Regulated upon activation, Normal T cell Expressed and presumable Secreted) is a CC-chemokine that can signal through the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. RANTES is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes in inflammatory sites. With the help of specific cytokines (i.e., IL-2 and IFN-γ) that are released by T cells, RANTES induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells. RANTES is also an HIV-suppressive factor released from CD8+ T cells. This chemokine has been localized to chromosome 17 in humans. It has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV) .Recombinant human RANTES/CCL5 produced in HEK293 cells is a single polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhRANTES/CCL5 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
RANTES, CCL5
Source
HEK 293
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of human RANTES/CCL5 on Caˆ2+ mobilization assay in CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells) is less than 0.2 μg/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human RANTES/CCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human RANTES/CCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE YINSLEMS

Related Products

CatalogName
GTR18990207-01RecombinantVEGF165, Human (HEK293-expressed)
GTR18990242-01RecombinantCNTF, Human (HEK293-expressed)
GTR18990232-01RecombinantIL-1RA, Human (HEK293-expressed)
GTR18990228-01RecombinantIL-22, Human (HEK293-expressed)
GTR18990231-01RecombinantIL-12, Human (HEK293-expressed)
GTR18990243-01RecombinantBetacellulin, Mouse (HEK293-expressed)
GTR18990217-01RecombinantOSM, Mouse (HEK293-expressed)
GTR18990211-01RecombinantSCF, Rat (HEK293-expressed)
GTR18990223-01RecombinantI‐TAC/CXCL11, Human (HEK293-expressed)
GTR18990240-01RecombinantENA-78/CXCL5, Human (HEK293-expressed)

Alternative Products

CatalogName
BK0329RecombinantRANTES/CCL5,Human(HEK293-expressed)
BK0329-01RecombinantRANTES/CCL5, Human (HEK293-expressed)
HY-P7282-01RANTES/CCL5, Human (HEK293)
TMPS-00121-01CCL5 Protein, Human, Recombinant (HEK293)
HY-P704860-01RANTES/CCL5, Human (HEK293, Fc)
MBS8114216-01Human CCL5/RANTES HEK293 Overexpression Lysate
Z03238-25RANTES/CCL5, Human (HEK 293-expressed)
bs-47447P-01Recombinant human CCL5 Protein, N-MBP & C-His (HEK293)
YP-W11742-01Human regulated on activation in normal T-cell expressed and secreted (RANTES; CCL5) ELISA Kit
361065-01RANTES, Recombinant, Human (Regulated on Activation, Normal T-cell Expressed and Secreted, CCL5) discontinued

Popular Products