Products for Research Use Only

RecombinantAmphiregulin, Human

CAT: 0384-BK0297-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0297-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
15~20 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK