Products for Research Use Only
RegisterLogin

RecombinantAmphiregulin, Human

CAT: 0013-GTR18990244-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990244-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
Product Name Alternative
AR, AREG, Colorectum cell-derived growth factor (CRDGF)
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
15~20 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK

Related Products

CatalogName
GTR18777889-01Human Human CYP19A1 Antibody
GTR19008890-01Human BDNF (BDNF Human) protein
GTR18882498-01Human human Septin-7 protein
GTR18834069-01Human Human Macrosialin ELISA Kit
GTR18880605-01Human Human Septin-7 protein
GTR18698434-01HuMax-IL8 Human Monoclonal Antibody
GTR18698323-01HuMax-IL15 Human Monoclonal Antibody
GTR17702017Rabbit Human Sirt1 Protein (Human) Antibody
GTR18877893Human Human IgG3 Lambda G3M (G)
GTR19008781-01Human ApoAI

Alternative Products

CatalogName
BK0297RecombinantAmphiregulin,Human
BK0297-01RecombinantAmphiregulin, Human
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
4062900/7HUMAN PHYSIOLOGY Human Head
4062900/1HUMAN PHYSIOLOGY The Human Skeleton
4062850/7HUMAN PHYSIOLOGY Human Ear
PT_41650-01Octreotide Human (OCT Human)

Popular Products