RecombinantBDNF, Human

CAT:
384-BK0184-01
Size:
5 μg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantBDNF, Human - image 1

RecombinantBDNF, Human

  • Description :

    BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.
  • Endotoxin :

    <0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE.
  • Bioactivity :

    ED50<4μg/ml, measured in a bioassay using C6 cells.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    12-14kDa, observed by reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant human BDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number :

    9000-83-3
  • AA Sequence :

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide