Products for Research Use Only

RecombinantIL-5Rα, Human

CAT: 0384-BK0248-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0248-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 <0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
53-56 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Interleukin-5 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-5 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE