RecombinantIL-18BP, Human

CAT:
384-BK0236-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantIL-18BP, Human - image 1

RecombinantIL-18BP, Human

  • Description :

    Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.
  • CAS Number :

    9000-83-3
  • Endotoxin :

    < 0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE and HPLC.
  • Bioactivity :

    ED50 < 30 ng /ml, measured in a bioassay using KG-1 cells in the presence of 50ng/ml Human IL-18.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    42-44 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • AA Sequence :

    TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHL PGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSP QQQG

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide