RecombinantIL-9, Human

CAT:
384-BK0259-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantIL-9, Human - image 1

RecombinantIL-9, Human

  • Description :

    Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
  • CAS Number :

    9000-83-3
  • Endotoxin :

    < 0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE and HPLC.
  • Bioactivity :

    ED50 < 1 ng/ml, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1x10ˆ6 units/mg.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    25-40 kDa, observed by non-reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • AA Sequence :

    QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide