RecombinantGDNF, Human

• Description:

  Glial cell line-derived neurotrophic factor (G-DNF) is a neurotrophic factors belong to TGF-beta super family necessary for neuron survival and phenotypic maintenance in central and peripheral nervous systems [1]. G-DNF has the potent to support the differentiation and survival of many neuron subpopulations, prominent for dopaminergic neurons [2] and motor neurons [3], as well as Purkinje cells and sympathetic neurons. Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells are known to express GDNF in human [4]. GDNF has shown to interact with GFRA2 and GDNF family receptor alpha 1 [5,6]. Mutations in this gene may be associated with Hirschsprung's disease, Parkinson's disease and amyotrophic lateral sclerosis (ALS) [7].The recombinant human G-DNF expressed in CHO cells is disulfide-linked homo-dimer, with an apparent molecular weight of ~30.4 kDa.

• Endotoxin:

  <0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE and HPLC.

• Bioactivity:

  ED50< 1 µg/ml, measured in a cell proliferation assay using rat C6 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant human Glial cell line-derived neurotrophic factor (G-DNF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-DNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  CHO

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI