HSP90 Protein

• Background:

  HSP90 is a highly conserved and abundantly expressed molecular chaperone that exists in two major cytosolic isoforms: HSP90α and HSP90β. It is essential for the folding, stabilization, and functional regulation of a wide array of client proteins, many of which are involved in signal transduction, cell cycle control, and stress responses. In the nervous system, HSP90 plays a critical role in maintaining proteostasis, particularly under conditions of cellular stress. It forms dynamic complexes with co-chaperones such as CDC37, p23, and immunophilins, which guide the maturation and stabilization of client proteins. This function is especially relevant in neurodegenerative diseases, where protein misfolding and aggregation are central pathological features. HSP90 has been shown to interact with key neurodegenerative disease-related proteins, including tau, α-synuclein, and huntingtin. While it can stabilize these proteins and prevent aggregation, it may also inadvertently preserve toxic conformers. As such, HSP90 is a double-edged sword in neurodegeneration—both protective and potentially pathogenic. Pharmacological inhibition of HSP90 has emerged as a therapeutic strategy to promote the degradation of misfolded proteins and restore cellular homeostasis. Its high expression in neurons and involvement in multiple neurodegenerative pathways make HSP90 a compelling target for therapeutic intervention and biomarker development.

• Description:

  P. Falciparum Recombinant HSP90 Partial Protein

• Product Name Alternative:

  HSP90, HSP90AB1, HSP90-beta, HSPCB, HSPC2, Heat shock protein HSP 90-beta, Heat shock 84 kDa protein, HSP84, HSP90B

• UNSPSC:

  12352202

• UN Code:

  Non-hazardous

• Hazard Statement:

  Non-hazardous

• Gene ID:

  811999

• Swiss Prot:

  Q8IL32

• Accession Number:

  XP_001348591.1

• Cellular Locus:

  Cytoplasm | Melanosome

• Expression System:

  E. coli

• Host:

  E. coli

• Origin Species:

  P. falciparum

• Target:

  HSP90

• Conjugation:

  No tag

• Nature:

  Recombinant

• Sequence:

  QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

• Applications:

  WB | SDS-PAGE

• Field of Research:

  Cancer | Heat Shock | Cell Signaling | Protein Trafficking | Chaperone Proteins | Cancer | Tumor Biomarkers

• Purification Method:

  Affinity Purified

• Purification:

  Affinity Purified

• Limit Of Detection:

  This product has been certified >90% pure using SDS-PAGE analysis.

• Concentration:

  Lot/batch specific. See included datasheet.

• Purity:

  >90%

• Weight:

  0.05

• Length:

  Partial

• Buffer:

  50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol

• Molecular Weight:

  ~21.4 kDa

• Precautions:

  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

• References & Citations:

  1. Nemoto T., et al. (1997) J.Biol Chem. 272: 26179-26187. 2. Minami Y., et al. (1991) J.Biol Chem. 266: 10099-10103. 3. Arlander S.J.H, et al. (2003) J Biol Chem. 278: 52572-52577. 4. Pearl H., et al. (2001) Adv Protein Chem. 59: 157-186. 5. Neckers L., et al. (2002) Trends Mol Med. 8: S55-S61. 6. Pratt W., Toft D. (2003) Exp Biol Med. 228: 111-133. 7. Pratt W., Toft D. (1997) Endocr Rev. 18: 306–360. 8. Pratt W.B. (1998) Proc Soc Exptl Biol Med. 217: 420–434. 9. Whitesell L., et al. (1994) Proc Natl Acad Sci USA. 91: 8324–8328. 10. Banumathy G., Singh V., Pavithra S.R., and Tatu U. (2003) J Biol Chem. 278(20): 18336-45. 11. Pavithra S.R, Banumathy G., Joy O., Singh V., and Tatu U. (2004) J Biol Chem. 279(45): 46692-9.

• Shipping Conditions:

  Blue Ice or 4ºC

• Storage Conditions:

  -20ºC

• Protein Length:

  Partial

• Background Reference 01:

  1. Nemoto T., et al. (1997) J.Biol Chem. 272: 26179-26187. 2. Minami Y., et al. (1991) J.Biol Chem. 266: 10099-10103. 3. Arlander S.J.H, et al. (2003) J Biol Chem. 278: 52572-52577. 4. Pearl H., et al. (2001) Adv Protein Chem. 59: 157-186. 5. Neckers L., et al. (2002) Trends Mol Med. 8: S55-S61. 6. Pratt W., Toft D. (2003) Exp Biol Med. 228: 111-133. 7. Pratt W., Toft D. (1997) Endocr Rev. 18: 306–360. 8. Pratt W.B. (1998) Proc Soc Exptl Biol Med. 217: 420–434. 9. Whitesell L., et al. (1994) Proc Natl Acad Sci USA. 91: 8324–8328. 10. Banumathy G., Singh V., Pavithra S.R., and Tatu U. (2003) J Biol Chem. 278 (20) : 18336-45. 11. Pavithra S.R, Banumathy G., Joy O., Singh V., and Tatu U. (2004) J Biol Chem. 279 (45) : 46692-9.

• Location:

  Cytoplasm | Melanosome

• AA Sequence:

  QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

• Immunogen Species:

  P. falciparum