Complement factor H/CFH, Human (HEK293, His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Complement factor H/CFH, Human (HEK293, His)
Description:
Complement factor H/CFH Protein, Human (HEK293, His) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].Product Name Alternative:
Complement factor H/CFH Protein, Human (HEK293, His), Human, HEK293UNSPSC:
12352202Purity:
96.00Smiles:
EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLMolecular Formula:
3075 (Gene_ID) P08603-2 (E19-L449) (Accession)Molecular Weight:
Approximately 49-54 kDa due to the glycosylation.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
