Complement factor H/CFH, Human (HEK293, His, solution)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


Complement factor H/CFH, Human (HEK293, His, solution)
Description :
Complement factor H/CFH Protein, Human (HEK293, His, solution) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].Product Name Alternative :
Complement factor H/CFH Protein, Human (HEK293, His, solution), Human, HEK293UNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/complement-factor-h-cfh-protein-human-hek-293-his.htmlPurity :
98.0Smiles :
EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLMolecular Formula :
3075 (Gene_ID) P08603-2 (E19-L449) (Accession)Molecular Weight :
Approximately 48 kDaReferences & Citations :
[1]Cui T, et al. Human complement factor H is a novel diagnostic marker for lung adenocarcinoma. Int J Oncol. 2011;39 (1) :161-168.|[2]Mandal MN, et al. Complement factor H: spatial and temporal expression and localization in the eye. Invest Ophthalmol Vis Sci. 2006;47 (9) :4091-4097.Shipping Conditions :
Dry ice.Storage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

