CCL21C, Mouse

• Description :

  CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  CCL21C Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Purity :

  98.00

• Smiles :

  SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

• Molecular Formula :

  100042493 (Gene_ID) P86793 (S24-G133) (Accession)

• Molecular Weight :

  Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins