CCL6, Mouse

• Description :

  CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].

• Product Name Alternative :

  CCL6 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ccl6-protein-mouse.html

• Purity :

  98.0

• Smiles :

  GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

• Molecular Formula :

  20305 (Gene_ID) P27784 (G22-A116) (Accession)

• Molecular Weight :

  Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Bing Ma, et al. The C10/CCL6 chemokine and CCR1 play critical roles in the pathogenesis of IL-13-induced inflammation and remodeling. J Immunol. 2004 Feb 1;172 (3) :1872-81.|[2]Andrew M LaFleur, et al. Role of CC chemokine CCL6/C10 as a monocyte chemoattractant in a murine acute peritonitis. Mediators Inflamm. 2004 Dec;13 (5-6) :349-55.|[3]Venkatesh Krishnan, et al. Omental macrophages secrete chemokine ligands that promote ovarian cancer colonization of the omentum via CCR1. Commun Biol. 2020 Sep 22;3 (1) :524.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins