Products for Research Use Only
RegisterLogin

CXCL16, Mouse

CAT: 0804-HY-P7151-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7151-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Mouse is produced in E. coli, and consists of 88 amino acids (N27-P114) .
Product Name Alternative
CXCL16 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cxcl16-protein-mouse.html
Purity
98.0
Smiles
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
Molecular Formula
66102 (Gene_ID) Q8BSU2 (N27-P114) (Accession)
Molecular Weight
Approximately 9.9 kDa
References & Citations
[1]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[2]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[3]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[4]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[5]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[6]Sheng Zuo, et al. CXCL16 Induces the Progression of Pulmonary Fibrosis through Promoting the Phosphorylation of STAT3. Can Respir J. 2019 Jul 10;2019:2697376.|[7]Yi Gong, et al. Prognostic and pathogenic role of CXC motif ligand 16 in sepsis. Microbes Infect. 2022 Feb;24 (1) :104882.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P84793-01CXCL16 Antibody (YA4490, Mouse)
HY-P77910-01CXCL16, Human (HEK293, Fc)
HY-P75313-01CXCL16, Rat (HEK293, His)
HY-P75697-01CXCL16, Canine (HEK293, His)
HY-P75696CXCL16, Canine (HEK293, Fc)
HY-P72961-01CXCL16, Human (HEK293, His)
HY-P75314CXCL16, Rat (HEK293, Fc)
HY-RS23128Cxcl16 Rat Pre-designed siRNA Set A
HY-RS03389CXCL16 Human Pre-designed siRNA Set A
HY-P71887A-01CXCL14/BRAK, Mouse (His)

Alternative Products

CatalogName
PT_40335-01CXCL16 Mouse Recombinant (CXCL16 Mouse)
MBS8575417-01CXCL16, Mouse
OM301597-01CXCL16 Mouse
MBS691753-01Mouse CXCL16
30R-AC078CXCL16 protein (mouse)
C8298-05-01CXCL16, Recombinant, Mouse
B2012086Mouse CXCL16 Protein
63523CXCL16 Mouse mAb
GTR19340720-01CXCL16 siRNA (Mouse)
17172054CXCL16 Adenovirus (Mouse)

Popular Products