TOP2A, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


TOP2A, Human
Description :
TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.Product Name Alternative :
TOP2A Protein, Human, Human, E. coliUNSPSC :
12352202Purity :
90Smiles :
SPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDMolecular Formula :
7153 (Gene_ID) P11388-1 (S1354-D1473) (Accession)Molecular Weight :
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Dry iceStorage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

