GDNF, Human

CAT:
804-HY-P7182-01
Size:
2 μg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GDNF, Human - image 1

GDNF, Human

  • Description:

    Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211) .
  • Product Name Alternative:

    GDNF Protein, Human, Human, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Applications:

    Neuroscience-Neuromodulation
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/gdnf-protein-human.html
  • Purity:

    97.66
  • Smiles:

    SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
  • Molecular Formula:

    2668 (Gene_ID) P39905-1 (S78-I211) (Accession)
  • Molecular Weight:

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations:

    [1]Schaar DG, et al. Multiple astrocyte transcripts encode nigral trophic factors in rat and human. Exp Neurol. 1994 Dec;130 (2) :387-93.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[4]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[5]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions:

    Stored at -20°C for 2 years
  • Scientific Category:

    Recombinant Proteins