GDNF, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


GDNF, Human
Description:
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211) .Product Name Alternative:
GDNF Protein, Human, Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsApplications:
Neuroscience-NeuromodulationAssay Protocol:
https://www.medchemexpress.com/cytokines/gdnf-protein-human.htmlPurity:
97.66Smiles:
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIMolecular Formula:
2668 (Gene_ID) P39905-1 (S78-I211) (Accession)Molecular Weight:
Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.References & Citations:
[1]Schaar DG, et al. Multiple astrocyte transcripts encode nigral trophic factors in rat and human. Exp Neurol. 1994 Dec;130 (2) :387-93.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[4]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[5]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
