Leptin, Human

• Description :

  Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human is a recombinant human Leptin protein expressed by E. coli without a tag.

• Product Name Alternative :

  Leptin Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/leptin-protein-human.html

• Purity :

  98.00

• Smiles :

  VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

• Molecular Formula :

  3952 (Gene_ID) P41159 (V22-C167) (Accession)

• Molecular Weight :

  Approximately 13-16 kDa

• References & Citations :

  [1]Chen K, et al. Induction of leptin resistance through direct interaction of C-reactive protein with leptin. Nat Med. 2006 Apr;12 (4) :425-32.|[2]Tsuchiya T, et al. Expression of leptin receptor in lung: leptin as a growth factor. Eur J Pharmacol. 1999 Jan 22;365 (2-3) :273-9.|[3]Lin YC, et al. Leptin decreases heart rate associated with increased ventricular repolarization via its receptor. Am J Physiol Heart Circ Physiol. 2015 Nov 15;309 (10) :H1731-9.|[4]Brzozowski T, et al. Brain-gut axis in gastroprotection by leptin and cholecystokinin against ischemia-reperfusion induced gastric lesions. J Physiol Pharmacol. 2001 Dec;52 (4 Pt 1) :583-602.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins