Leptin, Human

CAT:
804-HY-P7232-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Leptin, Human - image 1

Leptin, Human

  • Description :

    Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human is a recombinant human Leptin protein expressed by E. coli without a tag.
  • Product Name Alternative :

    Leptin Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/leptin-protein-human.html
  • Purity :

    98.00
  • Smiles :

    VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
  • Molecular Formula :

    3952 (Gene_ID) P41159 (V22-C167) (Accession)
  • Molecular Weight :

    Approximately 13-16 kDa
  • References & Citations :

    [1]Chen K, et al. Induction of leptin resistance through direct interaction of C-reactive protein with leptin. Nat Med. 2006 Apr;12 (4) :425-32.|[2]Tsuchiya T, et al. Expression of leptin receptor in lung: leptin as a growth factor. Eur J Pharmacol. 1999 Jan 22;365 (2-3) :273-9.|[3]Lin YC, et al. Leptin decreases heart rate associated with increased ventricular repolarization via its receptor. Am J Physiol Heart Circ Physiol. 2015 Nov 15;309 (10) :H1731-9.|[4]Brzozowski T, et al. Brain-gut axis in gastroprotection by leptin and cholecystokinin against ischemia-reperfusion induced gastric lesions. J Physiol Pharmacol. 2001 Dec;52 (4 Pt 1) :583-602.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide