MMP 9 Rabbit

• Description:

  MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707) . The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.

• Swiss Prot:

  P41246

• Source:

  Baculovirus system, insect cells.

• Buffer:

  The MMP-9 solution (0.3mg/mL) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.

• Storage Conditions:

  Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

• Sequence Similarities:

  APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQK