FGF-23, Human

• Description :

  FGF-23 Protein, Human is a unique FGF subfamily member, acts as a hormone and requires α-Klotho to signal through canonical FGFR, and induces hypertrophy and mineralization during chondrogenesis.

• Product Name Alternative :

  FGF-23 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-23-protein-human.html

• Purity :

  95.0

• Smiles :

  YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

• Molecular Formula :

  8074 (Gene_ID) Q9GZV9 (Y25-F251) (Accession)

• Molecular Weight :

  Approximately 25.3 kDa

• References & Citations :

  [1]Guibert M, et al. Fibroblast-growth factor 23 promotes terminal differentiation of ATDC5 cells. PLoS One. 2017 Apr 13;12 (4) :e0174969.|[2]Ohata Y, et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J Bone Miner Res. 2014 Jul;29 (7) :1627-38.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins