IL-6

• Description:

  Interleukin 6 (IL-6) is a pleiotropic α-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130) . IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.

• Synonyms:

  IL6; HGF; HSF; BSF2; IL-6; IFNB2

• NCBI Gene ID:

  3569

• UniProt:

  P05231

• Accession Number:

  NP_000591

• Accession Number mRNA:

  NM_000600

• Chromosomal Location:

  7p21

• Reactivity:

  Human

• Cross Reactivity:

  Human

• Sequence:

  MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Assay Protocol:

  The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

• Endotoxin:

  < 0.1 ng per µg (IEU/µg) of rh IL-6

• Purity:

  > 98% by SDS-PAGE

• Bioactivity:

  The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of ≤ 10 - 25 pg/ml.

• Length:

  186

• Form:

  Lyophilized (freeze-dried)

• Buffer:

  PBS

• Reconstitution:

  Water

• Molecular Weight:

  21.1 kDa

• Storage Conditions:

  The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-6 should be stored in working aliquots at -20°C.

• Host or Source:

  E. coli

• N Terminal Sequence:

  MAPVPPGE