IL-6

CAT:
209-200-031-L1000
Size:
1000 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-6 - image 1

IL-6

  • Description :

    Interleukin 6 (IL-6) is a pleiotropic α-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130) . IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.
  • Synonyms :

    IL6; HGF; HSF; BSF2; IL-6; IFNB2
  • NCBI Gene ID :

    3569
  • UniProt :

    P05231
  • Accession Number :

    NP_000591
  • Accession Number mRNA :

    NM_000600
  • Chromosomal Location :

    7p21
  • Reactivity :

    Human
  • Cross Reactivity :

    Human
  • Sequence :

    MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
  • Assay Protocol :

    The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  • Endotoxin :

    < 0.1 ng per µg (IEU/µg) of rh IL-6
  • Purity :

    > 98% by SDS-PAGE
  • Bioactivity :

    The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of ≤ 10 - 25 pg/ml.
  • Length :

    186
  • Form :

    Lyophilized (freeze-dried)
  • Buffer :

    PBS
  • Reconstitution :

    Water
  • Molecular Weight :

    21.1 kDa
  • Storage Conditions :

    The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-6 should be stored in working aliquots at -20°C.
  • Host or Source :

    E. coli
  • N Terminal Sequence :

    MAPVPPGE

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide