Bax Rabbit pAb (APR27554N)

CAT: 0882-APR27554N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR27554N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Bax Rabbit pAb (APR27554N) .

Synonyms

BCL2L4; BAX

Gene ID

581

UniProt

Q07812

Cellular Locus

Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein

Applications

WB (Mouse podocytes, Homo sapiens, Alpinia katsumadai Hayata) IF (Homo sapiens) IHC ()

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 4kDa/12kDa/15kDa/18kDa/19kDa/21kDa/24kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=581

Uniprot URL

https://www.uniprot.org/uniprot/Q07812

AA Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF

UniProtKB · Q07812

Apoptosis regulator BAX

BAX_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q07812
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: BAX
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: A8K4W1, P55269, Q07814, Q07815, Q8WZ49, Q9NR76, Q9NYG7, Q9UCZ6, Q9UCZ7, Q9UQD6

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

PTM

AcetylationIsopeptide bondUbl conjugation

Coding sequence diversity

Alternative splicing

Biological process

ApoptosisHost-virus interaction

Cellular component

CytoplasmMembraneMitochondrionMitochondrion outer membraneNucleus

Domain

TransmembraneTransmembrane helix

Disease

Tumor suppressor

Related Products

Catalog	Name
APR22212N-01	Bax Rabbit pAb (APR22212N)
APR22200N-01	[KO Validated] Bax Rabbit pAb (APR22200N)
APR17333N-01	[KO Validated] Bax Rabbit pAb (APR17333N)
APR18716N-01	[KO Validated] Bax Rabbit pAb (APR18716N)
APR18495N-01	[KO Validated] Bax Rabbit pAb (APR18495N)
APR28554N-01	SQRDL Rabbit pAb (APR28554N)
APR17554N-01	MyD88 Rabbit pAb (APR17554N)
APR27559N-01	GLUD1 Rabbit pAb (APR27559N)
APR27553N-01	LDHB Rabbit pAb (APR27553N)
APR27354N-01	SETDB2 Rabbit pAb (APR27354N)

Alternative Products

Catalog	Name
RTR015	Rabbit-to-Rabbit Blocking Reagent
ES20751-01	Gab1 Rabbit rabbit pAb
ES20703-01	JAK2 Rabbit rabbit pAb
ES20758-01	ERK1 Rabbit rabbit pAb
ES20659-01	NBR1 Rabbit rabbit pAb
ES20825-01	ATG7 Rabbit rabbit pAb
ES20831-01	ATG13 Rabbit rabbit pAb
ES20599-01	VEGF Rabbit rabbit pAb
ES20596-01	WIPI2 Rabbit rabbit pAb
AR05252PU-N	Rabbit IgG Rabbit Protein