CD9 Rabbit pAb (APR23487N)

CAT: 0882-APR23487N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23487N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD9 Rabbit pAb (APR23487N) .

Synonyms

BTCC-1; DRAP-27; MIC3; MRP-1; TSPAN-29; TSPAN29; CD9

Gene ID

928

UniProt

P21926

Cellular Locus

Cell membrane, Membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 22-35KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=928

Uniprot URL

https://www.uniprot.org/uniprot/P21926

AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

UniProtKB · P21926

CD9 antigen

CD9_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P21926
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD9
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: D3DUQ9, Q5J7W6, Q96ES4

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Biological process

Cell adhesionFertilization

Cellular component

Cell membraneMembraneSecreted

PTM

Disulfide bondGlycoproteinLipoproteinPalmitate

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
APR26487N-01	SERPINB9 Rabbit pAb (APR26487N)
APR23488N-01	RAB11A Rabbit pAb (APR23488N)
APR23481N-01	CEACAM1 Rabbit pAb (APR23481N)
APR23467N-01	UCP3 Rabbit pAb (APR23467N)
APR23427N-01	Smad2 Rabbit pAb (APR23427N)
APR27487N-01	CHN1 Rabbit pAb (APR27487N)
APR25487N-01	USH1C Rabbit pAb (APR25487N)
APR24487N-01	CD27 Rabbit pAb (APR24487N)
APR23987N-01	CD82 Rabbit pAb (APR23987N)
APR23887N-01	DECR2 Rabbit pAb (APR23887N)

Alternative Products

Catalog	Name
RTR015	Rabbit-to-Rabbit Blocking Reagent
ES20751-01	Gab1 Rabbit rabbit pAb
ES20703-01	JAK2 Rabbit rabbit pAb
ES20758-01	ERK1 Rabbit rabbit pAb
ES20659-01	NBR1 Rabbit rabbit pAb
ES20825-01	ATG7 Rabbit rabbit pAb
ES20831-01	ATG13 Rabbit rabbit pAb
ES20599-01	VEGF Rabbit rabbit pAb
ES20596-01	WIPI2 Rabbit rabbit pAb
AR05252PU-N	Rabbit IgG Rabbit Protein