CD4 Rabbit pAb (APR17427N)

CAT: 0882-APR17427N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR17427N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a membrane glycoprotein of T lymphocytes that interacts with major histocompatibility complex class II antigenes and is also a receptor for the human immunodeficiency virus. This gene is expressed not only in T lymphocytes, but also in B cells, macrophages, and granulocytes. It is also expressed in specific regions of the brain. The protein functions to initiate or augment the early phase of T-cell activation, and may function as an important mediator of indirect neuronal damage in infectious and immune-mediated diseases of the central nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD4 Rabbit pAb (APR17427N) .

Synonyms

CD4; CD4mut

Gene ID

920

UniProt

P01730

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa Observed MW: 51KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=920

Uniprot URL

https://www.uniprot.org/uniprot/P01730

AA Sequence

ALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALI

UniProtKB · P01730

T-cell surface glycoprotein CD4

CD4_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P01730
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD4
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: B2R737, D3DUS5, Q4ZGK2, Q5U066, Q9UDE5

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Biological process

Adaptive immunityHost-virus interactionImmunity

Cellular component

Cell membraneMembrane

PTM

Disulfide bondGlycoproteinLipoproteinPalmitatePhosphoprotein

Molecular function

Host cell receptor for virus entryReceptor

Domain

Immunoglobulin domainRepeatSignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
APR17426N-01	CD4 Rabbit pAb (APR17426N)
APR22055N-01	CD4 Rabbit pAb (APR22055N)
APR17422N-01	CD44 Rabbit pAb (APR17422N)
APR17431N-01	CD45 Rabbit pAb (APR17431N)
APR18427N-01	GSK3β Rabbit pAb (APR18427N)
APR17827N-01	CPD Rabbit pAb (APR17827N)
APR17472N-01	NEDD4 Rabbit pAb (APR17472N)
APR17423N-01	MDM2 Rabbit pAb (APR17423N)
APR17420N-01	AKT2 Rabbit pAb (APR17420N)
APR27427N-01	PCDHA13 Rabbit pAb (APR27427N)

Alternative Products

Catalog	Name
RTR125	Rabbit-to-Rabbit Blocking Reagent
ES20659-01	NBR1 Rabbit rabbit pAb
ES20825-01	ATG7 Rabbit rabbit pAb
ES20831-01	ATG13 Rabbit rabbit pAb
ES20599-01	VEGF Rabbit rabbit pAb
ES20596-01	WIPI2 Rabbit rabbit pAb
ES20751-01	Gab1 Rabbit rabbit pAb
ES20703-01	JAK2 Rabbit rabbit pAb
ES20758-01	ERK1 Rabbit rabbit pAb
AR05252PU-N	Rabbit IgG Rabbit Protein