Src Rabbit pAb (APR17416N)

CAT: 0882-APR17416N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR17416N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Src Rabbit pAb (APR17416N) .

Synonyms

ASV; SRC1; THC6; c-SRC; p60-Src; SRC

Gene ID

6714

UniProt

P12931

Cellular Locus

Cell membrane, Cytoplasm, Mitochondrion inner membrane, Nucleus, cytoskeleton

Applications

IHC (Human glioma cells, Mus musculus) WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:1000 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 59kDa/60kDa Observed MW: 60KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6714

Uniprot URL

https://www.uniprot.org/uniprot/P12931

AA Sequence

LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Related Products

Catalog	Name
APR24337N-01	Src Rabbit pAb (APR24337N)
APR18595N-01	Src Rabbit pAb (APR18595N)
AMR00961N-01	Phospho-SRC-S17 Rabbit pAb (AMR00961N)
AMR00866N-01	Phospho-Src-Y529 Rabbit pAb (AMR00866N)
AMR00939N-01	Phospho-SRC Family-Y416 Rabbit pAb (AMR00939N)
AMR00932N-01	Phospho-SRC Family-Y416 Rabbit pAb (AMR00932N)
AMR00918N-01	Phospho-SRC Family-Y416 Rabbit pAb (AMR00918N)
AMR00954N-01	Phospho-SRC Family-Y416 Rabbit pAb (AMR00954N)
APR17916N-01	BICD2 Rabbit pAb (APR17916N)
APR17418N-01	CD79a Rabbit pAb (APR17418N)

Alternative Products

Catalog	Name
RTR015	Rabbit-to-Rabbit Blocking Reagent
ES20751-01	Gab1 Rabbit rabbit pAb
ES20703-01	JAK2 Rabbit rabbit pAb
ES20758-01	ERK1 Rabbit rabbit pAb
ES20659-01	NBR1 Rabbit rabbit pAb
ES20825-01	ATG7 Rabbit rabbit pAb
ES20831-01	ATG13 Rabbit rabbit pAb
ES20599-01	VEGF Rabbit rabbit pAb
ES20596-01	WIPI2 Rabbit rabbit pAb
AR05252PU-N	Rabbit IgG Rabbit Protein

Src Rabbit pAb (APR17416N)

Related Products

Alternative Products

Popular Products