Products for Research Use Only
RegisterLogin

IL-17A, Human

CAT: 0804-HY-P7036-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7036-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human is a recombinant human IL-17A protein and is expressed in E. coli. It consists of 137 amino acids (I19-A155) .
Product Name Alternative
IL-17A Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-human.html
Purity
98.0
Smiles
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular Formula
3605 (Gene_ID) Q16552 (G24-A155) (Accession)
Molecular Weight
Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P76418-01IL-17A, Marmoset
HY-P73175A-01IL-17A, Rabbit
HY-179113IL-17A-IN-5
HY-P73170-01IL-17A, Canine
HY-K2107-01HOLO Human Interleukin-17A (IL-17A) Detection Kit
HY-P9927A-01Secukinumab (Anti-Human IL-17A)
HY-P73174-01IL-17A, Mouse (solution)
HY-101915-01IL-17A antagonist 3
HY-139686-01IL-17A inhibitor 2
HY-101913-01IL-17A antagonist 1

Alternative Products

CatalogName
MBS8575175-01IL-17A, Human
600136Human IL-17A
AP74783-01Recombinant Human Interleukin-17A/IL-17A
B2010266Interleukin-17A (IL-17A, Human, Recombinant)
32118-05111Human Interleukin-17A (IL-17A) Antibody
MBS9021040-01Human Interleukin 17A (IL-17A/IL-17) ELISA Kit
MBS702474-01Human Interleukin 17A, IL-17A/IL-17 ELISA Kit
EK710278Human Interleukin 17A (IL-17A,IL-17) Elisa Kit
PH2015-.01Recombinant Human IL-17A
MBS9719781-01Human IL-17A Protein

Popular Products