Products for Research Use Only
RegisterLogin

IL-17A, Human (CHO)

CAT: 0804-HY-P73171-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73171-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO) is a recombinant human IL-17A protein and is expressed in CHO cells. It consists of 155 amino acids (M1-A155) .
Product Name Alternative
IL-17A Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-human-cho.html
Purity
90.10
Smiles
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular Formula
3605 (Gene_ID) Q16552 (G24-A155) (Accession)
Molecular Weight
Approximately 32 kDa, based on SEC-MALS under reducing conditions, due to the glycosylation.
References & Citations
[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P79326-01IL-17A, Rat (CHO)
HY-P7372-01IL-17A, Mouse (CHO)
HY-P7036-01IL-17A, Human
HY-P704386-01IL-17A , Human (HEK293)
HY-P7037A-01IL-2, Human (CHO)
HY-P7033-01IL-13, Human (CHO)
HY-P7042-01IL-4, Human (CHO)
HY-P7044A-01IL-6, Human (CHO)
HY-P7043A-01IL-5, Human (CHO)
HY-P7211-01IL-18BP, Human (CHO)

Alternative Products

CatalogName
TMPY-07091-01IL-17A Protein, Human, Recombinant (CHO)
GTR19143965-01Recombinant human IL-17A protein (Active, CHO)
GTR19150032Recombinant human IL-17A protein (Active, CHO), BF647 conjugated
5837-IL-010Recombinant Human IL-17A/F Heterodimer (CHO-expressed) CF
GTR19150036-01Recombinant human IL-17A protein (Active, CHO), BF594 conjugated
OM296552-01IL 4 Human, CHO
OM296530-01IL 6 Human, CHO
PT_73429-01Interleukin-6 Recombinant Human, CHO (IL 6 Human, CHO)
PT_73440-01Interleukin-4 Human Recombinant, CHO (IL 4 Human, CHO)
Z03134-1IL-6, Human (CHO-expressed)

Popular Products