Products for Research Use Only
RegisterLogin

IL-17A, Marmoset

CAT: 0804-HY-P76418-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P76418-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Marmoset is a recombinant marmoset IL-17A protein is expressed in E. coli. It consists of 134 amino acids (I20-A153) .
Product Name Alternative
IL-17A Protein, Marmoset, Marmoset, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-marmoset.html
Purity
96.0
Smiles
IVKAGIASPQNPGCPNAEDKNFPRTVMVNLNIRNRNTNSKRASDYYNRSSSPWNLHRNEDPERYPSVIWEAKCRHLGCVDADGNVDYHMNSVPIQQEILVLRREPRHCTNSFRLEKMLVSVGCTCVTPIVRHVA
Molecular Formula
100385200 (Gene_ID) A5HJM0 (I20-A153) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73194IL-23, Marmoset (HEK293, His)
HY-P77402-01IL-12 beta, Marmoset (HEK293, Fc)
HY-P7036-01IL-17A, Human
HY-P73175A-01IL-17A, Rabbit
HY-179113IL-17A-IN-5
HY-P73170-01IL-17A, Canine
HY-P73174-01IL-17A, Mouse (solution)
HY-101915-01IL-17A antagonist 3
HY-139686-01IL-17A inhibitor 2
HY-P704386-01IL-17A , Human (HEK293)

Alternative Products

CatalogName
CT944-B5Marmoset IL-17A ELISPOT kit
CT343AMarmoset IL-17A ELISA kit
CT773-20Marmoset IL-17A ELISA antibody pair
CT968-10Marmoset IL-17A ELISPOT antibody pair
TMPY-03931-01IL-17 Protein, Marmoset, Recombinant
CT943-B2Marmoset IL-13 ELISPOT kit
CT344AMarmoset IL-2 ELISA kit
CT341AMarmoset IL-13 ELISA kit
CT339AMarmoset IL-6 ELISA kit
CT967-10Marmoset IL-13 ELISPOT antibody pair

Popular Products