Products for Research Use Only
RegisterLogin

IL-17A, Canine

CAT: 0804-HY-P73170-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73170-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Canine is a recombinant canine IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G26-A155) .
Product Name Alternative
IL-17A Protein, Canine, Canine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-canine.html
Purity
98.00
Smiles
GIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
Molecular Formula
481837 (Gene_ID) C6L8D7 (G26-A155) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Zhang L, et al. Plasma Erythropoietin, IL-17A, and IFNγ as Potential Biomarkers of Motor Function Recovery in a Canine Model of Spinal Cord Injury. J Mol Neurosci. 2020 Nov;70 (11) :1821-1828.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7036-01IL-17A, Human
HY-P76418-01IL-17A, Marmoset
HY-P73175A-01IL-17A, Rabbit
HY-179113IL-17A-IN-5
HY-P73174-01IL-17A, Mouse (solution)
HY-101915-01IL-17A antagonist 3
HY-139686-01IL-17A inhibitor 2
HY-P704386-01IL-17A , Human (HEK293)
HY-101913-01IL-17A antagonist 1
HY-148272-01IL-17A modulator-3

Alternative Products

CatalogName
DIY0960D-01Canine IL-17A ELISA
GTR18866779Canine IL-17A ELISpot
5848-CL-025Recombinant Canine IL-17A
GTR18906543-01Canine IL-17A protein
EK343942Canine IL-17A (Interleukin 17A) ValidElisa Kit
KLN0691GENLISA Canine Interleukin 17A (IL-17A) ELISA
EIA06855CaCanine Interleukin 17A (IL-17A) ELISA Kit
R00421-1Canine IL-17A Recombinant Protein
NR-E10014Canine IL-17A ELISA Kit
ATGP4068-020Recombinant canine IL-17A protein

Popular Products