Products for Research Use Only
RegisterLogin

Galectin-3/LGALS3, Human

CAT: 0804-HY-P70309-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70309-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].
Product Name Alternative
Galectin-3/LGALS3 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-human.html
Purity
98.00
Smiles
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Molecular Formula
3958 (Gene_ID) P17931 (A2-I250) (Accession)
Molecular Weight
Approximately 29 kDa
References & Citations
[1]Chaudoin TR, et al. Mice lacking galectin-3 (Lgals3) function have decreased home cage movement. BMC Neurosci. 2018 May 2;19 (1) :27. |[2]Demetriou M, et al. Negative regulation of T-cell activation and autoimmunity by Mgat5 N-glycosylation. Nature. 2001 Feb 8;409 (6821) :733-9. |[3]Chalise U, et al. Macrophages secrete murinoglobulin-1 and galectin-3 to regulate neutrophil degranulation after myocardial infarction. Mol Omics. 2022 Mar 28;18 (3) :186-195. |[4]Yoshimura A, et al. Increased expression of the LGALS3 (galectin 3) gene in human non-small-cell lung cancer. Genes Chromosomes Cancer. 2003 Jun;37 (2) :159-64. |[5]Kulow VA, et al. Galectin-3 protects distal convoluted tubules in rhabdomyolysis-induced kidney injury. Pflugers Arch. 2024 Jul 23. |[6]Braeuer RR, et al. Galectin-3 contributes to melanoma growth and metastasis via regulation of NFAT1 and autotaxin. Cancer Res. 2012 Nov 15;72 (22) :5757-66.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P79079-01Galectin-3/LGALS3, Mouse
HY-P77684-01Galectin-3/LGALS3, Mouse (HEK293, His)
HY-P700996-01Galectin-3/LGALS3, Cynomolgus (HEK293, His)
HY-P70190-01Galectin-8/LGALS8, Human
HY-P70358-01Galectin-7/LGALS7, Human
HY-P73072-01Galectin-1/LGALS1, Human
HY-155192Galectin-3/galectin-8-IN-2
HY-155191-01Galectin-3/galectin-8-IN-1
HY-163405Galectin-3-IN-3
HY-P73071Galectin-7/LGALS7, Human (GST)

Alternative Products

CatalogName
IT-300-004p-01Human Galectin-3/LGALS3 protein
MBS4159796-01Recombinant Human Galectin-3 (LGALS3)
abx655647-01Human Galectin 3 (LGALS3) Protein
ANT-36098-100ugHuman LGALS3/Galectin-3 Antibody
abx657208-01Human Galectin-3 (LGALS3) Protein
P515350Galectin-3; LGALS3 Protein (Human)
Z101825Recombinant Human Galectin-3 (LGALS3)
PT_40644-01Galectin-3 Human Recombinant (LGALS3 Human)
TMPY-02319-01Galectin-3/LGALS3 Protein, Human, Recombinant
abx151620-01Human Galectin 3 (LGALS3) ELISA Kit

Popular Products