Beta-NGF, Human (CHO)

CAT: 0804-HY-P73316-01Size: 50 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P73316-01Size:50 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.
Product Name Alternative
Beta-NGF Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-cho.html
Purity
96.00
Smiles
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Molecular Formula
4803 (Gene_ID) P01138 (S122-R239) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73317-01Beta-NGF, Mouse (CHO)
HY-P7660-01Beta-NGF, Human (HEK293)
HY-P70449-01Beta-NGF, Human (120a.a)
HY-P73128-01IFN-beta, Human (CHO)
HY-P72488-01Pro-Beta-NGF, Human (223a.a)
HY-P7205-01IL-1 beta, Human (CHO)
HY-P71171A-01NRG1-beta 1, Human (CHO)
HY-P704363-01Beta-NGF , Mouse (HEK293)
HY-P7661-01Beta-NGF, Mouse (120a.a)
HY-P70530-01Beta-NGF, Mouse (110a.a)

Alternative Products

CatalogName
PR27002-01NGF-b, Human, CHO
OM297562-01B NGF Human, CHO
PT_74848-01Beta-Nerve Growth Factor Human Recombinant, CHO (b NGF Human, CHO)
MBS8114335-01Human NGF CHO Overexpression Lysate
PROTP01138-1b-NGF Beta-Nerve Growth Factor Human Recombinant Protein, CHO
MBS554265-01Human TGF Beta-2 Recombinant (CHO Cell)
MBS555643-01Recombinant Human beta- Nerve Growth Factor CHO
MBS142123-01Recombinant Human beta Nerve Growth Factor, CHO
22060257-1Human beta Nerve Growth Factor, CHO (Recombinant)
MBS8114146-01Human TGF beta 1 CHO Overexpression Lysate

Popular Products