Products for Research Use Only

Beta-NGF, Mouse (120a.a)

CAT: 0804-HY-P7661-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7661-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
UNSPSC Description
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse (120a.a) is produced by E.coli (S122-G241), with tag free.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-120a-a.html
Purity
98.0
Smiles
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Molecular Weight
Approximately 14.0 kDa
References & Citations
[1]Yue XJ, et al. Over-expression of nerve growth factor-β in human cholangiocarcinoma QBC939 cells promote tumor progression. PLoS One. 2013;8(4):e62024. Published 2013 Apr 24.|[2]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26(153):717-722.|[3]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62(1):67-72.|[4]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[5]Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205(2):1187-93.
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years