Products for Research Use Only

IL-1 beta, Human (CHO)

CAT: 0804-HY-P7205-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7205-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (CHO) is produced in CHO cells, and consists of 153 amino acids (A117-S269) .
Product Name Alternative
IL-1 beta Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-cho.html
Purity
95.00
Smiles
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular Formula
3553 (Gene_ID) P01584 (A117-S269) (Accession)
Molecular Weight
Approximately 16-23 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins