Beta-NGF, Mouse (110a.a)

CAT: 0804-HY-P70530-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P70530-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse is produced by E.coli (M130-R239), with tag free.

Product Name Alternative

Beta-NGF Protein, Mouse (110a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-110a-a.html

Purity

98.0

Smiles

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Molecular Formula

18049 (Gene_ID) P01139 (M130-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205 (2) :1187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P704363-01	Beta-NGF , Mouse (HEK293)
HY-P7661-01	Beta-NGF, Mouse (120a.a)
HY-P73317-01	Beta-NGF, Mouse (CHO)
HY-P72449-01	TIGIT, Mouse (110a.a, HEK293, His)
HY-P700162AF-01	Animal-Free beta-NGF, Mouse (His)
HY-P7660-01	Beta-NGF, Human (HEK293)
HY-P73316-01	Beta-NGF, Human (CHO)
HY-P70449-01	Beta-NGF, Human (120a.a)
HY-P72488-01	Pro-Beta-NGF, Human (223a.a)
HY-P702778-01	Beta-NGF, Rat (HEK293, His)

Alternative Products

Catalog	Name
E55A12122	Mouse NGF/Beta-NGF Antibody
MBS9140098-01	Recombinant Mouse beta-NGF/beta-NGF Protein
MBS2547009-01	Recombinant Mouse beta-NGF / Beta-NGF Protein
E34M086M	Beta-NGF, Mouse
600207	Mouse NGF-beta
RC444270	Mouse Beta NGF
ARP4783-01	Recombinant Mouse β-NGF / Beta-NGF Protein
KMP1657-01	Recombinant Mouse beta-NGF/β-NGF Protein
GTR18685440-01	NGF/Beta-NGF Mouse Monoclonal Antibody
E55A04124	Mouse NGF/Beta-NGF Polyclonal Antibody

Beta-NGF, Mouse (110a.a)

Related Products

Alternative Products

Popular Products