Beta-NGF, Mouse (CHO)

CAT: 0804-HY-P73317-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P73317-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse (CHO) is produced by CHO cells (S122-G241), with tag free.

Product Name Alternative

Beta-NGF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-cho.html

Purity

98.0

Smiles

SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Molecular Formula

18049 (Gene_ID) P01139 (S122-G241) (Accession)

Molecular Weight

Approximately 13.5 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205 (2) :1187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P73316-01	Beta-NGF, Human (CHO)
HY-P704363-01	Beta-NGF , Mouse (HEK293)
HY-P7661-01	Beta-NGF, Mouse (120a.a)
HY-P70530-01	Beta-NGF, Mouse (110a.a)
HY-P70530A-01	Beta-NGF, Mouse (110a.a, His)
HY-P7073A-01	IL-1 beta, Mouse (CHO)
HY-P700162AF-01	Animal-Free beta-NGF, Mouse (His)
HY-P7660-01	Beta-NGF, Human (HEK293)
HY-P70449-01	Beta-NGF, Human (120a.a)
HY-P79084	IFN-beta, Rat (CHO)

Alternative Products

Catalog	Name
MBS8116574-01	Mouse NGF CHO Overexpression Lysate
MBS650588-01	Interferon beta, Recombinant, Mouse (CHO) (IFNb)
MBS584652	IFN-beta, Mouse, Recombinant (CHO derived)
I7662-11B	Interferon beta, Recombinant, Mouse (CHO) (IFNb) discontinued
GTR19150003-01	Recombinant mouse IFNB1/IFN-beta protein, C-Flag (CHO)
TMPS-00074-01	IL-1 beta/IL-1F2 Protein, Mouse, Recombinant (CHO)
7815-NG-025	Recombinant Rat beta-NGF (CHO-expressed)
7815-NG-025/CF	Recombinant Rat beta-NGF (CHO-expressed) CF
E55A12122	Mouse NGF/Beta-NGF Antibody
PR27002-01	NGF-b, Human, CHO

Beta-NGF, Mouse (CHO)

Related Products

Alternative Products

Popular Products