Recombinant Mouse TNF alpha
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Mouse TNF alpha
Description :
Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.Synonyms :
Mouse ; TNF alphaLabel :
ICTType :
Recombinant ProteinSource :
YeastSequence :
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)Assay Protocol :
The Mouse IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control.Form :
LyophilizedShipping Conditions :
Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority ShippingStorage Temperature :
-20°CNotes :
20% discountCalculated Molecular Weight :
17.3 kDaTarget Description :
Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

