Leptin, Rat

• Description :

  Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

• Product Name Alternative :

  Leptin Protein, Rat, Rat, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/leptin-protein-rat.html

• Purity :

  97.00

• Smiles :

  VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

• Molecular Formula :

  25608 (Gene_ID) P50596 (V22-C167) (Accession)

• Molecular Weight :

  Approximately 16.3 kDa

• References & Citations :

  [1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins