Products for Research Use Only
RegisterLogin

RecombinantMCP-1/CCL2, Mouse

CAT: 0013-GTR18990222-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990222-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several types of disease characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant mouse MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMCP-1/CCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
MCP-1; Monocyte Chemotactic Protein-1, CCL2, MCAF; JE
Source
HEK 293
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of mouse MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCCR2 cells (human Ga15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Mouse MCP-1°CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP-1°CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Related Products

CatalogName
GTR18990488-01RecombinantMCP-1/CCL2, Human
GTR18990221-01RecombinantMCP-1/CCL2, Rat
GTR18990275-01RecombinantMCP-5/CCL12, Mouse
GTR18990276-01RecombinantMCP‐3/MARC/CCL7, Mouse
GTR18990277-01RecombinantMCP‐3/CCL7, Human (CHO-expressed)
GTR18610136CCL2/CCL12 Antibody
GTR18610134CCL2/CCL12 Antibody
GTR18990220-01RecombinantMIP-1α/CCL3, Mouse
GTR18886544-01Mouse CCL2 protein
GTR19145160-01Mouse CCL2 protein

Alternative Products

CatalogName
BK0320-01RecombinantMCP-1/CCL2, Mouse
BK0320RecombinantMCP-1/CCL2,Mouse
BK0266RecombinantMCP-5/CCL12,Mouse
BK0266-01RecombinantMCP-5/CCL12, Mouse
BK0265-01RecombinantMCP‑3/MARC/CCL7, Mouse
BK0265RecombinantMCP‑3/MARC/CCL7,Mouse
HY-P7764-01MCP-1/CCL2, Mouse
YP-W22324-01Mouse CCL2 (CCL2) ELISA Kit
MBS8575397-01CCL2, Mouse
P513778CCL2; MCP-1 Protein (Mouse)

Popular Products