Products for Research Use Only

MCP-1/CCL2, Mouse

CAT: 0804-HY-P7764-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7764-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil[1].
Product Name Alternative
MCP-1/CCL2 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-1-ccl2-protein-mouse.html
Purity
98.0
Smiles
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Molecular Formula
20296 (Gene_ID) P10148 (Q24-R96) (Accession)
Molecular Weight
Approximately 9-12 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Martha Gschwandtner, et al. More Than Just Attractive: How CCL2 Influences Myeloid Cell Behavior Beyond Chemotaxis. Front Immunol. 2019 Dec 13;10:2759.|[2]Qiongyu Hao, et al. CCL2/CCR2 signaling in cancer pathogenesis. Cell Commun Signal. 2020 May 29;18 (1) :82.|[3]Svetlana M Stamatovic, et al. Monocyte chemoattractant protein-1 regulation of blood-brain barrier permeability. J Cereb Blood Flow Metab. 2005 May;25 (5) :593-606.|[4]Rachel N Gomes, et al. Bacterial clearance in septic mice is modulated by MCP-1/CCL2 and nitric oxide. Shock. 2013 Jan;39 (1) :63-9.|[5]Lijun Zhang, et al. Effect of chemokine CC ligand 2 (CCL2) on α?synuclein?induced microglia proliferation and neuronal apoptosis. Mol Med Rep. 2018 Nov;18 (5) :4213-4218.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins